PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN17572.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 365aa    MW: 41002.7 Da    PI: 6.8478
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN17572.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.25.1e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd  l+ ++++ G+g +W + ++++g++R++k+c++rw++yl
       KHN17572.1 14 KGPWSPEEDATLKTYIEKNGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding38.92e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T+eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
       KHN17572.1  69 GGFTEEEDNIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.8962IPR017930Myb domain
SuperFamilySSF466892.6E-2611109IPR009057Homeodomain-like
SMARTSM007171.4E-111364IPR001005SANT/Myb domain
PfamPF002491.8E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-241569IPR009057Homeodomain-like
CDDcd001672.27E-81662No hitNo description
PROSITE profilePS5129422.10963117IPR017930Myb domain
SMARTSM007172.3E-1167115IPR001005SANT/Myb domain
PfamPF002496.1E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2370117IPR009057Homeodomain-like
CDDcd001672.63E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MGRAPCCDKN NVKKGPWSPE EDATLKTYIE KNGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FTEEEDNIIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGR  120
RKQSNFSSKD TNNGIEENSY SNALSTSALE RLQLHMQLQS LQNPFSFYNN PALWPKLHPI  180
QEKMIHSLQS LNDGSNPVMQ NALPNSPHDE QGQKGEFYKP QHDGAKINNP DQVHLLENIP  240
LSNSGVPFVA SGSSTNPMHS SLAPRSEAIH VQTNNNVGFQ QLGALQNELD EILNNRTMGY  300
VPQEDHDMAS GFDCFREMND SKDSLIWWSN DSDTKSASSN SWESSATPAL LTQGMFQDYE  360
LGYSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-23141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006600502.10.0PREDICTED: transcription factor RAX1-like
SwissprotQ9FKL21e-101MYB36_ARATH; Transcription factor MYB36
TrEMBLA0A0B2QCM90.0A0A0B2QCM9_GLYSO; Transcription factor RAX3
TrEMBLI1MST60.0I1MST6_SOYBN; Uncharacterized protein
STRINGGLYMA17G07330.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.11e-93myb domain protein 36
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]